sample stability raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-05-24. Anything still debated is marked as such rather than presented as settled.
Quality control for glutathione focuses on identity, purity, and oxidation state. Certificates of analysis may report assay value, water content, and the presence of GSSG or other impurities. Chromatographic purity is often expressed as a percentage of peak area. Reference standards help laboratories compare results across instruments and batches. Because glutathione is a small, polar molecule, separation from cysteine, gamma-glutamylcysteine, and related thiols can be challenging. Verification often combines more than one analytical technique.
Measuring glutathione requires attention to sample preparation because the molecule oxidizes readily. Blood, tissue, and cell samples are often treated with acid to precipitate proteins and stabilize the thiol. Without such steps, GSH can convert to GSSG or form mixed disulfides during storage. Analytical methods include spectrophotometric assays, high-performance liquid chromatography, and mass spectrometry. Each approach has different sensitivity, specificity, and susceptibility to interference from related compounds in complex matrices.
Cells synthesize glutathione through two ATP-dependent steps: glutamate-cysteine ligase joins glutamate and cysteine, and glutathione synthetase adds glycine to form the complete tripeptide. Breakdown occurs through gamma-glutamyl transpeptidase and subsequent peptidase reactions, forming the gamma-glutamyl cycle. Within cells, glutathione also forms a disulfide-linked dimer called GSSG when two GSH molecules react. The balance between GSH and GSSG is widely used as an indicator of oxidative conditions, although the ratio can vary by compartment and tissue.
Glutathione supports several cellular processes beyond direct antioxidant action. It serves as a cofactor for glutathione peroxidase and glutathione S-transferase enzymes, which reduce peroxides and conjugate electrophiles, respectively. The molecule also acts as a reservoir of cysteine, an amino acid that can limit protein synthesis and redox signaling. In human nutrition, oral glutathione is sold as a supplement, but how much intact glutathione reaches tissues after ingestion remains an active research question. Clinical claims about supplementation are not uniformly supported by controlled trials.
| Property | Value | Notes |
|---|---|---|
| Typical assay | HPLC-UV or LC-MS/MS | Derivatization may improve detection |
| Storage temperature | -20 °C or below | Keep desiccated and protected from light |
| Appearance | White to off-white crystalline powder | Reduced form |
| Solubility | Freely soluble in water | Insoluble in lipids and nonpolar solvents |
| Common synonyms | L-Glutathione; GSH | GSH denotes reduced form |
Laboratory measurement of glutathione requires attention to oxidation before analysis. Blood, tissue, or cell samples can lose reduced glutathione as it converts to GSSG or forms mixed disulfides with proteins. Acid extraction, rapid freezing, and thiol-blocking reagents are common strategies to preserve the original distribution. Reported concentrations therefore depend on collection protocol, extraction method, and the time between sampling and analysis. Comparisons across studies are most reliable when these pre-analytical variables are described.
Common analytical approaches include enzymatic recycling assays, high-performance liquid chromatography, and mass spectrometry. The enzymatic recycling assay uses glutathione reductase and a colorimetric or fluorometric reagent to amplify signal, which gives good sensitivity for total glutathione. Chromatographic methods can separate GSH from GSSG and related thiols, while mass spectrometry offers structural confirmation and multiplexing. Each approach has different requirements for calibration, internal standards, and validation. No single method captures every form of glutathione in every matrix.
Glutathione is a small tripeptide composed of glutamate, cysteine, and glycine, with the unusual gamma-glutamyl linkage between glutamate and cysteine. Its cysteine thiol group makes it a major non-enzymatic antioxidant in cells. The reduced form, GSH, predominates in most intracellular compartments, while the oxidized disulfide form, GSSG, is produced when GSH reduces reactive oxygen species. Intracellular concentrations often reach millimolar levels, whereas plasma concentrations are much lower, typically in the low micromolar range. This gradient reflects active synthesis, transport, and consumption rather than passive distribution.
Synthesis occurs in two ATP-dependent steps: glutamate-cysteine ligase joins glutamate and cysteine to form gamma-glutamylcysteine, and glutathione synthetase adds glycine to complete the tripeptide. The pathway is feedback-inhibited by GSH and limited by cysteine availability, so cysteine supply often constrains production. Once formed, GSH participates in redox buffering, xenobiotic conjugation, and protein glutathionylation. Glutathione peroxidase uses GSH to reduce hydrogen peroxide and lipid peroxides, yielding GSSG, while glutathione reductase regenerates GSH using NADPH. Glutathione S-transferases conjugate electrophiles to GSH, supporting detoxification and excretion.
Because GSH is central to redox balance, its status is studied in aging, liver disease, neurodegenerative conditions, and metabolic disorders. Observational studies often report lower GSH or higher GSSG in affected tissues, but such associations do not establish that raising glutathione changes disease outcomes. Oral glutathione is digested into amino acids, and whether intact absorption occurs remains debated; precursors such as N-acetylcysteine and cysteine donors are also investigated. Regulatory agencies generally treat glutathione as a dietary supplement, not an approved drug, and clinical claims require evidence from controlled trials.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
=== Frameshift === A recessive frameshift mutation resulting in a reduction of leptin has been observed in two consanguineous children with juvenile obesity. A 2001 study of 13 people with a heterozygous frameshift mutation known as delta-G133 found that they had lower blood leptin levels than controls. There was an increased rate of obesity in these individuals, with 76% having a BMI of more than 30 compared to 26% in the control group.
Only the last display in the daisy-chain does not need to support the feature specifically or have a DP output port. DisplayPort 1.1 displays can also be connected to MST hubs, and can be part of a DisplayPort daisy-chain if it is the last display in the chain. The host system's software also needs to support MST for hubs or daisy-chains to work. While Microsoft Windows environments have full support for it, Apple operating systems currently do not support MST hubs or DisplayPort daisy-chaining as of macOS 10.15 ("Catalina"). DisplayPort-to-DVI and DisplayPort-to-HDMI adapters/cables may or may not function from an MST output port; support for this depends on the specific device. MST is supported by USB Type-C DisplayPort Alternate Mode, so standard DisplayPort daisy-chains and MST hubs do function from Type-C sources with a simple Type-C to DisplayPort adapter.
== History == The first barbiturate drug, barbital, was synthesized in 1902 by German chemists Emil Fischer and Joseph von Mering and was first marketed as Veronal by Friedr. Bayer et comp. By 1904, several related drugs, including phenobarbital, had been synthesized by Fischer. Phenobarbital was brought to market in 1912 by the drug company Bayer as the brand Luminal. It remained a commonly prescribed sedative and hypnotic until the introduction of benzodiazepines in the 1960s. Phenobarbital's soporific, sedative and hypnotic properties were well known in 1912, but it was not yet known to be an effective anticonvulsant. The young doctor Alfred Hauptmann gave it to his epilepsy patients as a tranquilizer and discovered their seizures were susceptible to the drug. Hauptmann performed a careful study of his patients over an extended period. Most of these patients were using the only effective drug then available, bromide, which had terrible side effects and limited efficacy. On phenobarbital, their epilepsy was much improved: those with the most severe disease had fewer and lighter seizures while some patients became seizure-free. In addition, they improved physically and mentally as bromides were removed from their regimen. Patients who had been institutionalised due to the severity of their epilepsy were able to leave and, in some cases, resume employment. Hauptmann dismissed concerns that its effectiveness in stalling seizures could lead to patients developing a build-up that needed to be "discharged".
Sources: en.wikipedia.org
Users have reported that mephedrone causes euphoria, stimulation, an enhanced appreciation for music, an elevated mood, decreased hostility, improved mental function and mild sexual stimulation; these effects are similar to the effects of cocaine, amphetamines and MDMA, and last different lengths of time depending on the way the drug is taken. Of 70 Dutch users of mephedrone, 58 described it as an overall pleasant experience, and 12 described it as an unpleasant experience. In a survey of UK users who had previously taken cocaine, most users found it produced a better-quality and longer-lasting high and was less addictive. The users were also asked to compare the "risk", and they answered that it was equal. A study of users in Northern Ireland found they did not equate the fact that mephedrone was legal with it being safe to use. This was contrary to another study in New Zealand, where users of benzylpiperazine thought that because it was legal, it was safe.
Anne-Claude Gingras is a senior investigator at Lunenfeld-Tanenbaum Research Institute, and a professor in the department of molecular genetics at the University of Toronto. She is an expert in mass spectrometry based proteomics technology that allows identification and quantification of protein from various biological samples. Gingras was born on Île d'Orléans, Quebec. She earned her undergraduate degree at Université Laval in Quebec. She completed her PhD in biochemistry at McGill University in Montreal, studying how 4E-BP1 regulated translation initiation, under the mentorship of Nahum Sonenberg. After graduating in 2001, she began postdoctoral research in Seattle at the Institute for Systems Biology in the lab of Ruedi Aebersold, where she studied proteomics for three years. In 2005, Gingras moved to Toronto and joined the Lunenfeld-Tanenbaum Research Institute, and in 2006, she began teaching at the University of Toronto in the department of molecular genetics.
In bioconjugation (forming a stable covalent link between a biomolecule and a functional payloads, such as fluorescent dyes, cytotoxic agents, or tracers), linking of the payload was classically achieved using maleimide heterobifunctional reagents (for example, see SMCC). However, when administered into living organisms, maleimide-containing bioconjugates were found to be relatively unstable and lose the payload in the blood circulation due to reversibility of the addition reaction between maleimide moiety and cysteine residue of a protein (retro Michael addition). Due to increased stability of bioconjugates obtained with analogous APN-based payloads (a schematic reaction is shown in the Figure 2 below), their use is often preferable when high selectivity and biostability are especially important: namely for the preparation of antibody−drug conjugates and other biologics. Standard procedure for APN protein labeling consists in incubation of a protein containing free cysteine residues with an APN-functionalized probe in PBS buffer at pH 7.5-9.0 at room temperature for 2–12 hours, followed by an optional step of purification of the resulting bioconjugate using size exclusion chromatography or ultrafiltration.
Sources: en.wikipedia.org
Common methods include spectrophotometric enzyme cycling assays, HPLC with UV or fluorescence detection, and LC-MS/MS. Detection often requires derivatization because glutathione lacks a strong chromophore. Method choice depends on the sample type and the required sensitivity.
Yes, especially in solution or when exposed to oxygen, light, and heat. The reduced form can oxidize to GSSG or form disulfides with other thiols. Powdered material stored cool and dry is generally more stable than aqueous preparations.
Purity refers to the proportion of the intended compound in a sample, often determined by chromatography. A high purity value does not necessarily indicate a specific oxidation state. Buyers may also need information about GSSG content, water, and residual solvents.
It is a tripeptide of glutamic acid, cysteine, and glycine. The linkage between glutamate and cysteine uses the gamma-carboxyl group, which is unusual for peptides.