The short version of thiol group fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-07-11. Anything still debated is marked as such rather than presented as settled.
Several analytical methods can quantify glutathione, including high-performance liquid chromatography (HPLC) with UV or fluorescence detection for separating GSH and GSSG. Liquid chromatography-tandem mass spectrometry (LC-MS/MS) offers higher specificity and sensitivity, often detecting nanomolar concentrations. The enzymatic recycling assay, often called the Tietze method, measures total glutathione by coupling reduction of GSSG to a colorimetric or fluorometric readout. Capillary electrophoresis and electrochemical detection are also used in specialized laboratories. Each method has distinct advantages and limitations regarding throughput, cost, and susceptibility to interference.
Interpreting glutathione measurements requires attention to pre-analytical variables. The GSSG concentration in a sample can rise artificially during storage or processing, making the GSH/GSSG ratio unreliable if not controlled. Reference ranges vary by specimen type, assay, and population, so comparisons across studies are difficult. Plasma glutathione is low and sensitive to hemolysis, while whole blood reflects primarily erythrocyte content. Many studies measure total glutathione rather than the reduced and oxidized forms separately, which limits conclusions about redox status.
Accurate measurement of glutathione begins with careful sample handling. Because GSH oxidizes rapidly to GSSG, samples must be processed quickly or frozen immediately. Acid precipitation with metaphosphoric acid or perchloric acid is common; it lowers pH, precipitates proteins, and helps preserve the reduced form. Chelating agents such as EDTA can limit metal-catalyzed oxidation. For whole blood, hemolysis releases glutathione from erythrocytes, so plasma and serum values differ substantially from whole blood values.
Quality control for glutathione measurements includes calibration with authenticated standards, internal standards where available, blank correction, and spike recovery checks. Because glutathione can form during sample processing or degrade before analysis, pre-analytical handling is a major source of variability. Interlaboratory comparisons often show differences in reported values due to method-specific calibration and detection principles. Interpretive thresholds are context-dependent, and no single reference range applies across all tissues or matrices. Researchers generally report both reduced and oxidized forms, along with the method and sample handling details.
Quantification of glutathione in biological or food samples commonly uses liquid chromatography coupled to ultraviolet, fluorescence, electrochemical, or mass spectrometric detection. Because the thiol group oxidizes readily, samples are often acidified or derivatized immediately after collection to stabilize reduced glutathione. Enzymatic recycling assays and colorimetric kits offer higher throughput but generally lower specificity than chromatographic methods. Mass spectrometry can distinguish glutathione from related thiols and allow simultaneous measurement of oxidized forms. Reported concentrations depend strongly on sample type, extraction procedure, and analytical platform.
Glutathione reference materials are sensitive to oxygen, light, and elevated temperature. Solid material is typically stored desiccated at -20 °C or below, while solutions require tighter control because thiol oxidation proceeds faster in liquid form. Aqueous solutions are often prepared fresh, kept cold, and protected from air; some protocols add acid or chelating agents to slow metal-catalyzed oxidation. Repeated freeze-thaw cycles can accelerate degradation and should be avoided. Stability data vary by matrix, so laboratories usually verify performance with their own storage conditions.
| Property | Value | Notes |
|---|---|---|
| Common analytical method | LC-MS/MS or HPLC | Separation of GSH and GSSG |
| Limit of detection | Nanomolar range | Method dependent |
| Typical sample storage | -80 °C | For biological matrices |
| Common reducing agent | TCEP or DTT | Prevents oxidation during processing |
| Common synonym | Gamma-glutamylcysteinylglycine | Systematic name |
Cells synthesize glutathione through two ATP-dependent enzymatic steps. The first step combines glutamate and cysteine to form gamma-glutamylcysteine, catalyzed by glutamate-cysteine ligase. The second step adds glycine, producing the complete tripeptide, catalyzed by glutathione synthetase. Glutathione itself can inhibit the first enzyme, providing negative feedback when levels are high. Because cysteine is often limiting, its availability influences how quickly the pathway proceeds. These reactions occur in the cytosol, and the resulting glutathione can be distributed to other compartments.
Glutathione functions in redox balance, detoxification, and sulfur amino acid storage. It participates in reactions that help maintain ascorbate and protein thiol status. The molecule serves as a cofactor for several enzymes, including glutathione peroxidases and glutathione S-transferases. These enzymes reduce peroxides and conjugate electrophiles, respectively. Glutathione also contributes to the metabolism of xenobiotics and to the transport of cysteine between tissues. How interorgan transport and tissue-specific regulation shape whole-body pools remains an active area of study.
For solid glutathione reagents, storage at low temperature and protection from moisture and light are typical precautions. Aqueous solutions can oxidize over time, and pH affects stability; alkaline conditions generally promote thiol oxidation. Some protocols prepare fresh solutions, while others use antioxidants or chelators to limit metal-catalyzed oxidation. Purity and counterion content can vary among commercial preparations, affecting concentration calculations. Certificates of analysis and validated assays help verify identity and purity.
Measuring glutathione in biological samples requires attention to oxidation, because GSH can convert to GSSG after sample collection. Blood and plasma samples are often treated with acid or alkylating agents to preserve the reduced form. Without stabilization, apparent GSH concentrations can fall while GSSG rises. Differences in sample type, handling delay, and deproteinization method can produce results that are not comparable across studies. Reporting preanalytical details is therefore important for interpreting findings.
==== 1966 White Paper: major cuts and a new name ==== This was followed by a large reduction and complete reorganisation, announced in the 1966 Defence White Paper and implemented from 1 April 1967, when the title Territorial and Army Volunteer Reserve (TAVR) was adopted. This abolished the former divisional structure of the TA. The size of the TAVR was to be reduced from 107,000 to under 50,000, with the infantry reduced from 86 to 13 battalions and the yeomanry (armoured units) from 20 to one. Units in the new TAVR were divided into various categories:
International Campaign for Justice in Bhopal Bhopal Medical Appeal Bhopal Gas Tragedy Relief & Rehabilitation Department at the Government of Madhya Pradesh Bhopal Information Center, Union Carbide India Environmental Portal Archived 14 October 2023 at the Wayback Machine Updated news on Bhopal Gas Disaster Bhopal:Anatomy of a Crisis by Paul Shrivastava, Paul Chapman Publishing, 1987, ISBN 1-85396-192-2 Bhopal Gas Disaster Girl picture.
==== Canada ==== As of October 2018, when recreational use of cannabis was legalized in Canada, some 220 dietary supplements and 19 veterinary health products, containing not more than 10 parts per million of THC extract, were approved with general health claims for treating minor conditions.
== The industry == Within the chemical universe, the fine chemical industry is positioned between the commodity, their suppliers, and specialty chemical industries, their customers. Depending on the services offered, there are two types of fine chemical companies. Fine chemical companies are active in industrial scale production, both of standard and exclusive products. Fine chemical companies tend to fall into one of three categories: producers are referred to as Custom Manufacturing Organizations (CMOs); Contract Research Organizations (CROs)' main assets are their research laboratories; and CRAMS (Contract Research and Manufacturing Organizations are hybrids between the two.
=== Ethylene vinyl alcohol co-polymer in dimethyl sulfoxide === 8% ethylene vinyl alcohol co-polymer in dimethyl sulfoxide solution has been used. For FI it is marketed as Onyx34, and for gastroesophageal reflux disease it is marketed as Enteryx. After injection, it forms a spongy solid mass via solidification of the hydrophobic copolymer. This occurs because the co-polymer is hydrophic, and the solvent is dissolved away upon contact with tissues. In one publication inter-sphincteric injection site was used via the inter-sphincteric route.
Sources: en.wikipedia.org
=== Hearing loss === Alport syndrome can also cause hearing loss although some patients are not affected. Hearing in Alport syndrome patients is normal at birth. Hearing loss in affected patients develops progressively, usually at the stage when kidney function is normal, but there is substantial proteinuria. However, in some patients, hearing loss is only noted after kidney function has been lost. Characteristically the early changes are reduced ability to hear high-frequency sounds, sensorineural deafness. This becomes more severe and affects lower frequencies too. Hearing loss is not usually complete in Alport syndrome; good communication is almost always possible with the use of hearing aids.
== Media image == Larter first appeared in the media when she portrayed the fictional character of Allegra Coleman in the November 1996 issue of Esquire. The magazine, which billed Coleman as the movies' next dream girl, relayed Allegra's relationship with David Schwimmer, how Quentin Tarantino broke up with Mira Sorvino to date her, and Woody Allen then overhauled a film to give her a starring role. When the magazine was published, Esquire received hundreds of phone calls about the non-existent Coleman and various talent agencies sought to represent her, even after the hoax was revealed. Larter herself received a considerable amount of attention after the cover; she received phone calls from morning TV shows and others for interviews. The Esquire cover led Larter to a role on Varsity Blues. One particular scene where Larter's character, Darcy Sears, wears nothing but whipped cream to cover herself has become a media favorite. It has been referenced many times in the media including on MTV's Jersey Shore, where a character refers to it as being the "Varsity Blues outfit". Larter has been acknowledged as a scream queen by MSN due to her appearances in horror/thriller films. After the success of Heroes, she appeared on People's "Ten Best Dressed List" as "The Newcomer" in 2007. In 2009, she was named Cosmopolitan's Fun Fearless Female of the year at a ceremony held in Beverly Hills, California.
=== Value of tracking symptom occurrence === The appearance of these signs and symptoms can not only provide clues for the diagnosis of an autoimmune condition, often in conjunction with tests for specific biological markers, but also help monitor disease progression and response to treatment. Ultimately, due to the diverse nature of autoimmune diseases, a multidimensional approach is often needed for the management of these conditions, taking into consideration the variety of symptoms and their impacts on individuals' lives.
=== Radiological === Natural thorium decays very slowly compared to many other radioactive materials, and the emitted alpha radiation cannot penetrate human skin. As a result, handling small amounts of thorium, such as those in gas mantles, is considered safe, although the use of such items may pose some risks. Exposure to an aerosol of thorium, such as contaminated dust, can lead to increased risk of cancers of the lung, pancreas, and blood, as lungs and other internal organs can be penetrated by alpha radiation. Internal exposure to thorium leads to increased risk of liver diseases. The decay products of 232Th include more dangerous radionuclides such as radium and radon. Although relatively little of those products are created as the result of the slow decay of thorium, a proper assessment of the radiological toxicity of 232Th must include the contribution of its daughters, some of which are dangerous gamma emitters, and which are built up quickly following the initial decay of 232Th due to the absence of long-lived nuclides along the decay chain. As the dangerous daughters of thorium have much lower melting points than thorium dioxide, they are volatilised every time the mantle is heated for use. In the first hour of use large fractions of the thorium daughters 224Ra, 228Ra, 212Pb, and 212Bi are released. Most of the radiation dose by a normal user arises from inhaling the radium, resulting in a radiation dose of up to 0.2 millisieverts per use, about a third of the dose sustained during a mammogram.
Sources: en.wikipedia.org
On 28 March 2026 during the 2026 Iran war, a Houthi missile was launched from Yemen toward Beersheba in Southern Israel after its leader gave a speech. Hours later they confirmed launching a second missile.
The trial, carried out between 1946 and 1947, aimed to test the efficacy of the chemical streptomycin for curing pulmonary tuberculosis. The trial was both double-blind and placebo-controlled. The methodology of clinical trials was further developed by Sir Austin Bradford Hill, who had been involved in the streptomycin trials. From the 1920s, Hill applied statistics to medicine, attending the lectures of renowned mathematician Karl Pearson, among others. He became famous for a landmark study carried out in collaboration with Richard Doll on the correlation between smoking and lung cancer. They carried out a case-control study in 1950, which compared lung cancer patients with matched control and also began a sustained long-term prospective study into the broader issue of smoking and health, which involved studying the smoking habits and health of more than 30,000 doctors over a period of several years. His certificate for election to the Royal Society called him "the leader in the development in medicine of the precise experimental methods now used nationally and internationally in the evaluation of new therapeutic and prophylactic agents". The ethics of selecting clinical trial subjects have been controversial for much of their modern history, especially in the United States. From the 1950s up until the early 1970s, the vast majority of pharmaceutical testing in America was performed on prison populations; only after widespread abuse during testing was reported at the Holmesburg Prison did research diminish in these areas.
==== Competitive ==== A competitive inhibitor and substrate cannot bind to the enzyme at the same time. Often competitive inhibitors strongly resemble the real substrate of the enzyme. For example, the drug methotrexate is a competitive inhibitor of the enzyme dihydrofolate reductase, which catalyzes the reduction of dihydrofolate to tetrahydrofolate. The similarity between the structures of dihydrofolate and this drug are shown in the accompanying figure. This type of inhibition can be overcome with high substrate concentration. In some cases, the inhibitor can bind to a site other than the binding-site of the usual substrate and exert an allosteric effect to change the shape of the usual binding-site.
=== Detection in biological fluids === Oxycodone or its major metabolites may be measured in blood or urine to monitor for clearance, non-medical use, confirm a diagnosis of poisoning, or assist in a medicolegal death investigation. Many commercial opiate screening tests cross-react appreciably with oxycodone and its metabolites, but chromatographic techniques can easily distinguish oxycodone from other opiates.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
Sources: en.wikipedia.org
Glutathione oxidizes quickly when cells are disrupted or when samples sit at room temperature. Rapid processing or immediate freezing minimizes the conversion of GSH to GSSG. This step helps ensure that the measured ratio reflects the original biological state.
The Tietze assay is an enzymatic recycling method that measures total glutathione. It uses glutathione reductase to reduce GSSG back to GSH, which then reacts with a chromogen or fluorophore. The reaction cycles repeatedly, amplifying the signal for detection.
Yes, but the choice of blood fraction matters. Plasma or serum contains low glutathione levels and is easily affected by hemolysis. Whole blood mainly reflects the high glutathione content of erythrocytes, so results from different fractions are not directly comparable.
Acidification lowers pH and helps prevent oxidation of the thiol group during extraction and storage. It can also precipitate proteins and stabilize the reduced form before analysis.