The short version of GSSG fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-03-01. Anything still debated is marked as such rather than presented as settled.
In living systems, glutathione occurs in millimolar concentrations in many cell types, while extracellular levels are generally much lower. The liver holds a substantial share of the body's total pool, and the molecule participates in reduction, detoxification, and amino acid transport. It also serves as a cofactor for enzymes such as glutathione peroxidase and glutathione S-transferase. Because the cysteine residue supplies a reactive thiol, glutathione can donate electrons and become oxidized. Cells regenerate reduced glutathione through glutathione reductase using NADPH.
Commercial glutathione is produced by microbial fermentation or chemical synthesis, then purified. Reduced and oxidized grades are offered separately, with purity specifications often exceeding 98 percent. The compound appears in foods such as fresh fruits, vegetables, and meats, although cooking and processing can lower amounts. Oral, topical, and inhaled forms are discussed in research and consumer contexts, but absorption and tissue delivery remain active areas of study. Regulatory status varies by country and intended use.
Glutathione is a small sulfur-containing peptide built from glutamic acid, cysteine, and glycine. Its distinctive feature is a gamma-glutamyl bond between glutamate's side-chain carboxyl group and cysteine's amino group. This linkage resists ordinary peptidases and helps the molecule remain stable inside cells. The reduced thiol form, often abbreviated GSH, is the dominant intracellular species. The oxidized disulfide dimer, GSSG, forms when two reduced molecules link through their cysteine sulfur atoms. The balance between these forms is a common redox indicator.
Quality control for glutathione focuses on identity, purity, and oxidation state. Certificates of analysis may report assay value, water content, and the presence of GSSG or other impurities. Chromatographic purity is often expressed as a percentage of peak area. Reference standards help laboratories compare results across instruments and batches. Because glutathione is a small, polar molecule, separation from cysteine, gamma-glutamylcysteine, and related thiols can be challenging. Verification often combines more than one analytical technique.
Measuring glutathione requires attention to sample preparation because the molecule oxidizes readily. Blood, tissue, and cell samples are often treated with acid to precipitate proteins and stabilize the thiol. Without such steps, GSH can convert to GSSG or form mixed disulfides during storage. Analytical methods include spectrophotometric assays, high-performance liquid chromatography, and mass spectrometry. Each approach has different sensitivity, specificity, and susceptibility to interference from related compounds in complex matrices.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C10H17N3O6S | Reduced glutathione (GSH) |
| Molar mass | 307.32 g/mol | Oxidized dimer GSSG is 612.63 g/mol |
| Appearance | White to off-white crystalline powder | Typical purified solid |
| Solubility | Freely soluble in water; practically insoluble in ethanol | Polarity reflects multiple ionizable groups |
| Common synonyms | GSH; L-glutathione; γ-glutamylcysteinylglycine | 'Reduced' distinguishes it from GSSG |
For solid glutathione reagents, storage at low temperature and protection from moisture and light are typical precautions. Aqueous solutions can oxidize over time, and pH affects stability; alkaline conditions generally promote thiol oxidation. Some protocols prepare fresh solutions, while others use antioxidants or chelators to limit metal-catalyzed oxidation. Purity and counterion content can vary among commercial preparations, affecting concentration calculations. Certificates of analysis and validated assays help verify identity and purity.
Measuring glutathione in biological samples requires attention to oxidation, because GSH can convert to GSSG after sample collection. Blood and plasma samples are often treated with acid or alkylating agents to preserve the reduced form. Without stabilization, apparent GSH concentrations can fall while GSSG rises. Differences in sample type, handling delay, and deproteinization method can produce results that are not comparable across studies. Reporting preanalytical details is therefore important for interpreting findings.
Several techniques are used for quantification. Enzymatic recycling assays rely on glutathione reductase and a colorimetric or fluorescent readout, offering sensitivity for total glutathione. High-performance liquid chromatography can separate GSH from GSSG and other thiols, often with UV, fluorescence, or electrochemical detection. Mass spectrometry provides structural confirmation and can quantify low-abundance species when paired with separation. Each approach has trade-offs in specificity, throughput, and equipment requirements, so method selection depends on the research question and available instrumentation.
Stability depends on pH, temperature, oxygen exposure, and trace metals. Aqueous solutions of reduced glutathione are susceptible to oxidation, especially when neutral or alkaline and exposed to air. Transition metal ions can catalyze thiol oxidation, so chelators and inert atmospheres are sometimes used in research settings. Standards are typically stored cold and desiccated, with limited freeze-thaw cycles. Questions remain about how closely in vitro stability data reflect the behavior of glutathione within intact cells and tissues.
Measuring glutathione requires attention to oxidation during sample handling, because GSH in biological samples can convert to GSSG or form mixed disulfides with proteins after collection. Acidic extraction, rapid cooling, and chelating agents are commonly used to limit such changes. Analytical methods usually distinguish free reduced glutathione, total glutathione, and protein-bound forms. Because these forms have different stability and reactivity, reported values depend heavily on the preparation protocol. No single preparation is universally suitable for every biological matrix or analytical goal.
Quantifying glutathione requires distinguishing GSH from GSSG and preventing oxidation during sample preparation. Common approaches include the enzymatic recycling assay, often called the Tietze method, which measures total glutathione after converting GSSG to GSH. HPLC with ultraviolet or fluorescence detection and LC-MS/MS can separate and quantify both forms, sometimes after derivatization of the thiol group. Blood, plasma, and tissue samples differ in matrix and baseline concentrations, so method validation must account for recovery, linearity, and interference. No single assay is universally standard.
Glutathione is most stable as a dry powder stored cool and dry, but its thiol group is readily oxidized in solution. Aqueous preparations at neutral or alkaline pH lose GSH faster because the thiolate form reacts with dissolved oxygen and metal ions. Acidic conditions, chelating agents, and oxygen exclusion can slow oxidation, while repeated freeze-thaw cycles promote degradation. Light exposure and trace metals also contribute to loss. Laboratories typically validate stability for their own matrices because degradation rates depend on pH, temperature, concentration, and container materials.
== In other organisms == Many bacteria synthesize menaquinones from chorismic acid. They use it as a part of the electron transport chain, playing a similar role as other quinones such as ubiquinone. Oxygen, heme, and menaquinones are needed for many species of lactic acid bacteria to conduct respiration. Variations in biosynthetic pathways mean that bacteria also produce analogues of vitamin K2. For example, MK9(II-H), which replaces the second geranylgeranyl unit with a saturated phytyl, is produced by Mycobacterium phlei. There also exists a possibility of cis–trans isomerism due to the double bonds present. In M. phlei, the 3'-methyl-cis MK9(II-H) form seems to be more biologically active than trans MK9(II-H). However, with human enzymes, the naturally abundant trans form is more efficient. One hydrogenated MK that sees relevant amounts of human consumption is MK-9(4H), found in cheese fermented by Propionibacterium freudenreichii. This variation has the second and third units replaced with phytyl.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Eosinophilic cutaneous conditions encompass a wide variety of diseases that are characterized histologically by the presence of eosinophils in the inflammatory infiltrate, or evidence of eosinophil degranulation.
=== Mechanism === The sulfhydryl groups of several cysteines surround the glucose binding site. All except cys 230 are essential for the catalytic process, forming multiple disulfide bridges during interaction with the substrates and regulators. At least in the beta cells, the ratio of active to inactive glucokinase molecules is at least partly determined by the balance of oxidation of sulfhydryl groups or reduction of disulfide bridges. These sulfhydryl groups are quite sensitive to the oxidation status of the cells, making glucokinase one of the components most vulnerable to oxidative stress, especially in the beta cells.
=== Religious alignment === Since 1660, nonconformist Protestants have played a major role in English politics. Relatively few MPs were Dissenters. However the Dissenters were a major voting bloc in many areas, such as the East Midlands. They were very well organised and highly motivated and largely won over the Whigs and Liberals to their cause. Down to the 1830s, Dissenters demanded removal of political and civil disabilities that applied to them (especially those in the Test and Corporation Acts). The Anglican establishment strongly resisted until 1828. Numerous reforms of voting rights, especially that of 1832, increased the political power of Dissenters. They demanded an end to compulsory church rates, in which local taxes went only to Anglican churches. They finally achieved the end of religious tests for university degrees in 1905. Gladstone brought the majority of Dissenters around to support for Home Rule for Ireland, putting the dissenting Protestants in league with the Irish Roman Catholics in an otherwise unlikely alliance. The Dissenters gave significant support to moralistic issues, such as temperance and sabbath enforcement. The nonconformist conscience, as it was called, was repeatedly called upon by Gladstone for support for his moralistic foreign policy. In election after election, Protestant ministers rallied their congregations to the Liberal ticket. In Scotland, the Presbyterians played a similar role to the Nonconformist Methodists, Baptists and other groups in England and Wales.
Sources: en.wikipedia.org
At 10:20 pm, the tank was at normal pressure, indicating the absence of water. At 10:45 pm, a shift change took place, after which the MIC storage area "would be completely deserted". During this period, a "disgruntled operator entered the storage area and hooked up one of the readily available rubber water hoses to Tank 610, with the intention of contaminating and spoiling the tank's contents." Water began to flow, beginning the chemical reaction that caused the disaster. After midnight, control room operators noticed the pressure rising and realized there was a problem with Tank 610. They discovered the water connection and decided to transfer one ton of the contents out to try to remove the water. The MIC release then occurred. The cover-up activities discovered during the investigation then took place. After over 30 years, in November 2017, S. P. Choudhary, former MIC production manager, claimed in court that the disaster was not an accident but the result of a sabotage that claimed thousands of lives. Choudhary's counsel, Anirban Roy, argued that the theory of design defects was floated by the central government in its endeavour to protect the victims of the tragedy. Everyone else involved in investigating the case "just toed the line of the central government. ... The government and the CBI suppressed the actual truth and saved the real perpetrators of the crime." Roy argued to the district court that M. L. Verma, a disgruntled plant operator at odds with senior management, was behind the sabotage.
=== Trypsin-like === Trypsin-like proteases cleave peptide bonds following a positively charged amino acid (lysine or arginine). This specificity is driven by the residue which lies at the base of the enzyme's S1 pocket (generally a negatively charged aspartic acid or glutamic acid).
=== Economics === Economists have modeled the circumstances under which slavery (and variants such as serfdom) appear and disappear. One theoretical model is that slavery becomes more desirable for landowners where land is abundant, but labour is scarce, such that rent is depressed and paid workers can demand high wages. If the opposite holds true, then it is more costly for landowners to guard the slaves than to employ paid workers who can demand only low wages because of the degree of competition. Thus, first slavery and then serfdom gradually decreased in Europe as the population grew. They were reintroduced in the Americas and in Russia as large areas of land with few inhabitants became available. Slavery is more common when the tasks are relatively simple and thus easy to supervise, such as large-scale monocrops such as sugarcane and cotton, in which output depended on economies of scale. This enables systems of labour, such as the gang system in the United States, to become prominent on large plantations where field hands toiled with factory-like precision. Then, each work gang was based on an internal division of labour that assigned every member of the gang to a task and made each worker's performance dependent on the actions of the others. The slaves chopped out the weeds that surrounded the cotton plants as well as excess sprouts. Plow gangs followed behind, stirring the soil near the plants and tossing it back around the plants. Thus, the gang system worked like an assembly line.
On 20 January 2001 the Indian Space Research Organisation (ISRO) conducted a balloon flight from Hyderabad, India to collect stratospheric dust from a height of 41 km (135,000 ft) with a view to testing for the presence of living cells. The collaborators on this project included a team of UK scientists led by Wickramasinghe. In a paper presented at a SPIE conference in San Diego in 2002 the detection of evidence for viable microorganisms from 41 km above the Earth's surface was presented. However, the experiment did not present evidence as to whether the findings are incoming microbes from space rather than microbes carried up to 41 km from the surface of the Earth. In 2005 the ISRO group carried out a second stratospheric sampling experiment from 41 km altitude and reported the isolation of three new species of bacteria including one that they named Janibacter hoylei sp.nov. in honour of Fred Hoyle. However, these facts do not prove that bacteria on Earth originated in the cosmic environment. Samplings of the stratosphere have also been carried out by Yang et al. (2005, 2009). During the experiment strains of highly radiation-resistant Deinococcus bacterium were detected at heights up to 35 km. Nevertheless, these authors have abstained from linking these discoveries to panspermia. Wickramasinghe was also involved in coordinating analyses of the red rain in Kerala in collaborations with Godfrey Louis.
On 30 August 2023, Health Secretary Steve Barclay announced that it would be upgraded to a statutory inquiry, enabling witnesses to be compelled to give evidence. The inquiry, chaired by Lady Justice Thirlwall, formally opened on 22 November 2023. The public hearings began on 10 September 2024. In a ruling on 29 May 2024, the chair determined that remote live viewing would be available to Core Participants, their legal representatives and the media, but not to the wider public. During the hearings, colleagues gave evidence describing Letby as "excited and gossipy" when discussing the death of an infant, saying she preferred caring for unwell babies, complained when moved to less acute areas, and expressed eagerness for the first death of an infant to "get it out of the way". Former Health Secretary Jeremy Hunt apologised to families during the 2025 hearings, saying the government had taken "too long" to act. Letby's lawyers and other supporters later asked for the inquiry to be paused while her application to the Criminal Cases Review Commission was considered. Thirlwall rejected the request in March 2025 and said she intended to deliver her report in November 2025. In April 2026, the inquiry said that work on the report was still ongoing and that a publication date could not be confirmed.
Sources: en.wikipedia.org
It is a tripeptide rather than a full protein. Proteins generally contain many amino acids joined by alpha-peptide bonds, while glutathione has three residues and an unusual gamma-glutamyl linkage. That structure affects how enzymes recognize and break it down.
GSH is the reduced form with a free thiol group. GSSG is the oxidized disulfide dimer formed when two GSH molecules react. The GSH-to-GSSG ratio is used in research as one indicator of cellular redox conditions.
Yes, it is present in many animal and plant tissues, including meats, some vegetables, and fruits. Heat, storage, and processing can reduce its content, so measured amounts vary widely.
Common methods include spectrophotometric enzyme cycling assays, HPLC with UV or fluorescence detection, and LC-MS/MS. Detection often requires derivatization because glutathione lacks a strong chromophore. Method choice depends on the sample type and the required sensitivity.