The short version of tripeptide fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2025-10-30. Anything still debated is marked as such rather than presented as settled.
Glutathione is a small tripeptide made of glutamic acid, cysteine, and glycine. Its cysteine thiol group allows reversible oxidation and reduction, making it central to cellular redox chemistry. The reduced form, often abbreviated GSH, predominates inside most cells, while the oxidized disulfide form, GSSG, forms when two GSH molecules react. The ratio of GSH to GSSG is widely used as an indicator of oxidative stress in laboratory research, though it does not by itself diagnose a clinical condition.
Biosynthesis occurs in two ATP-dependent steps. The enzyme glutamate-cysteine ligase joins glutamate and cysteine, forming gamma-glutamylcysteine; glutathione synthetase then adds glycine to produce the complete tripeptide. Because the peptide bond from glutamate uses the gamma-carboxyl group, glutathione resists digestion by many ordinary peptidases. Tissues vary in synthesis capacity, and the liver generally contains high concentrations relative to many other organs. This uneven distribution contributes to organ-specific differences in redox buffering and affects how experimental results are interpreted across tissue types.
Glutathione is synthesized in two ATP-dependent steps. First, gamma-glutamylcysteine synthetase links glutamate and cysteine; second, glutathione synthetase adds glycine to form the complete tripeptide. The pathway is feedback-inhibited by GSH itself, which helps maintain steady intracellular levels. Tissues vary widely in glutathione content, with the liver typically containing the highest concentrations, followed by the kidneys, lungs, and erythrocytes. Because cysteine is often limiting, its availability influences synthesis rates, and regulation of this pathway varies by cell type.
Glutathione serves as a cofactor for several enzymes, including glutathione peroxidase and glutathione S-transferase. These enzymes help reduce hydrogen peroxide and lipid peroxides, and they conjugate reactive electrophiles for excretion. The molecule also acts as a reservoir for cysteine, an amino acid that is prone to oxidation. In addition, glutathione participates in the metabolism of nitric oxide, leukotrienes, and prostaglandins. Its roles extend to cell signaling, apoptosis, and the regulation of protein function through S-glutathionylation.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine, and it is the most abundant non-protein thiol in most living cells. The reduced form, GSH, carries a sulfhydryl group that can donate electrons, while the oxidized form, GSSG, forms when two GSH molecules link via a disulfide bond. The balance between these two forms helps define the cellular redox environment, and their ratio is often used as an indicator of oxidative stress. Because the sulfhydryl group is reactive, glutathione participates in many cellular processes, including detoxification and protein regulation.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C10H17N3O6S | Reduced glutathione (GSH); oxidized form differs by disulfide linkage. |
| Molar mass | 307.32 g/mol | Calculated for the reduced tripeptide. |
| Appearance | White to off-white crystalline powder | Typical laboratory reagent description. |
| Solubility | Soluble in water | Aqueous solutions are acidic; solubility depends on pH and salt form. |
| CAS Registry Number | 70-18-8 | Refers to reduced L-glutathione; oxidized form has a different number. |
Functionally, glutathione supports redox balance by donating electrons and becoming oxidized. It also serves as a cofactor for enzymes such as glutathione peroxidases and glutathione S-transferases. These enzymes participate in peroxide reduction and in conjugation reactions that help process reactive molecules. Separate from antioxidant roles, glutathione can modify protein cysteines through S-glutathionylation, influencing enzyme activity and signaling. Research continues to examine how these chemical roles translate into whole-organism effects.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. Its glutamate-cysteine linkage uses the gamma-carboxyl group of glutamate, a feature that resists standard peptidases. The cysteine residue provides a thiol group, which gives the molecule its reducing character. In cells, glutathione is often the most abundant small-molecule thiol, with concentrations varying widely by tissue and compartment. It exists mainly in a reduced form called GSH, while oxidation produces a disulfide-linked dimer called GSSG.
Biosynthesis proceeds in two ATP-dependent steps. First, glutamate-cysteine ligase joins glutamate and cysteine. Second, glutathione synthetase adds glycine to the intermediate. The pathway is regulated by cysteine availability, enzyme expression, and feedback inhibition by glutathione itself. Liver tissue has a particularly high capacity for synthesis and export. Because the molecule is made inside cells, circulating glutathione reflects a balance of release, uptake, and breakdown rather than simple dietary supply.
Quality control for glutathione focuses on identity, purity, and oxidation state. Certificates of analysis may report assay value, water content, and the presence of GSSG or other impurities. Chromatographic purity is often expressed as a percentage of peak area. Reference standards help laboratories compare results across instruments and batches. Because glutathione is a small, polar molecule, separation from cysteine, gamma-glutamylcysteine, and related thiols can be challenging. Verification often combines more than one analytical technique.
Measuring glutathione requires attention to sample preparation because the molecule oxidizes readily. Blood, tissue, and cell samples are often treated with acid to precipitate proteins and stabilize the thiol. Without such steps, GSH can convert to GSSG or form mixed disulfides during storage. Analytical methods include spectrophotometric assays, high-performance liquid chromatography, and mass spectrometry. Each approach has different sensitivity, specificity, and susceptibility to interference from related compounds in complex matrices.
Glutathione functions in redox balance, detoxification, and sulfur amino acid storage. It participates in reactions that help maintain ascorbate and protein thiol status. The molecule serves as a cofactor for several enzymes, including glutathione peroxidases and glutathione S-transferases. These enzymes reduce peroxides and conjugate electrophiles, respectively. Glutathione also contributes to the metabolism of xenobiotics and to the transport of cysteine between tissues. How interorgan transport and tissue-specific regulation shape whole-body pools remains an active area of study.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. Its cysteine residue carries a thiol group, which allows the molecule to participate in reduction and oxidation reactions. The compound exists in most living cells, where the reduced form, often abbreviated GSH, is usually more abundant than the oxidized disulfide form, GSSG. Intracellular concentrations are commonly in the millimolar range, while extracellular concentrations are much lower. This uneven distribution supports its role as a major cellular redox buffer.
Cells synthesize glutathione through two ATP-dependent enzymatic steps. The first step combines glutamate and cysteine to form gamma-glutamylcysteine, catalyzed by glutamate-cysteine ligase. The second step adds glycine, producing the complete tripeptide, catalyzed by glutathione synthetase. Glutathione itself can inhibit the first enzyme, providing negative feedback when levels are high. Because cysteine is often limiting, its availability influences how quickly the pathway proceeds. These reactions occur in the cytosol, and the resulting glutathione can be distributed to other compartments.
Samples for glutathione analysis require careful handling because the compound oxidizes readily and can be consumed by enzymes after collection. Blood is often treated with acid or thiol-blocking agents soon after draw, and plasma should be separated quickly from red blood cells. Tissues are usually snap-frozen or extracted immediately. Aqueous solutions of glutathione are less stable than dry powder and degrade faster at neutral or alkaline pH, in light, or with dissolved oxygen. Repeated freeze-thaw cycles also reduce reliability.
Quality control for glutathione materials checks identity, assay, purity, water content, and disulfide content. Commercial products vary from research-grade powder to dietary supplements, and labels may not distinguish reduced from oxidized forms. In the United States, oral glutathione is commonly sold as a dietary supplement rather than an approved drug, while injectable forms fall under different rules and may require a prescription. Regulatory status differs by country. Analytical certificates, when available, help verify what a material contains, but independent testing remains important for interpretation.
Laboratory measurement of glutathione typically starts with rapid acid extraction to prevent oxidation and enzymatic degradation. Common methods include enzymatic recycling assays, high-performance liquid chromatography, and liquid chromatography coupled with mass spectrometry. The recycling assay uses glutathione reductase and a thiol-reactive colorimetric or fluorescent reagent, measuring total glutathione after converting disulfide forms. Chromatographic methods can separate reduced and oxidized forms, which helps when the redox ratio is the target. Choice of method affects sensitivity, specificity, and the amount of sample needed.
As of 2018, the overwhelming majority of bitcoin transactions took place on cryptocurrency exchanges. Since 2014, regulated bitcoin funds also allow exposure to the asset or to futures as an investment. Bitcoin is used as a store of value: individuals and companies such as the Winklevoss twins and Elon Musk's companies SpaceX and Tesla have each bought and sold hundreds of millions of dollars worth of bitcoin. Bitcoin wealth is highly concentrated, with 0.01% holding 27% of in-circulation currency, as of 2021. As of March 2025, El Salvador had $550 million worth of bitcoin in its international reserves, about 6,102 coins. Bitcoin, along with other cryptocurrencies, has been described as an economic bubble by several economists, including Nobel Prize in Economics laureates, such as Joseph Stiglitz, James Heckman, and Paul Krugman. Another recipient of the prize, Robert Shiller, argues that bitcoin is rather a fad that may become an asset class. He describes its price growth as an "epidemic", driven by contagious narratives. In 2024, Jean Tirole, also Nobel laureate, described bitcoin as a "pure bubble" as its intrinsic value is zero. According to him, some bubbles are long-lasting such as gold and fiat currencies, and it is impossible to predict whether bitcoin would implode like other financial bubbles or become an alternative to gold. The same year, Federal Reserve Chair Jerome Powell described bitcoin as a digital competitor to gold but not to the dollar as he argued it is a highly volatile speculative asset not used as a form of payment.
Meanwhile, workers in the platelet, extracellular matrix, and cell surface fields were also working on multi-subunit receptors. The platelet receptor for fibrinogen contained two glycoprotein subunits termed IIb and IIIa. A monoclonal antibody to a cell surface receptor that blocked cell adhesion to laminin and fibronectin reacted with three distinct subunits in the same molecular weight range as αLβ, αMβ, αXβ, and IIb/IIIa. Proteins with high molecular weight, sharing a common subunit, were identified on lymphocytes and non-hematopoietic cells. After the discovery that an RGD motif in fibronectin is sufficient for recognition by its receptor and common to other extracellular proteins, the fibronectin and vitronectin receptors were isolated and their sequences determined and platelet protein IIb/IIIa was also shown to recognize RGD. Sequences of these receptors showed that their alpha subunit sequences were homologous to one another and to those earlier reported for LFA-1 (αLβ) and Mac-1 (αMβ). A large number of other papers appeared in 1986-1987 reporting further sequences and relationships among these receptors, including from the Springer lab on the β-subunit shared by LFA-1 (αLβ), Mac-1 (αMβ), and αXβ. Richard Hynes chaired the 1987 Gordon Research Conference on Fibronectin. Hynes had worked on fibronectin, and in 1986 his group isolated a cDNA encoding a subunit recognized by an antibody to the laminin and fibronectin receptors, which he named integrin.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
=== Studies indicating negligible effects === Studies in 2005 and earlier have concluded that DU ammunition has no measurable detrimental health effects. A 1999 literature review conducted by the Rand Corporation stated: "No evidence is documented in the literature of cancer or any other negative health effect related to the radiation received from exposure to depleted or natural uranium, whether inhaled or ingested, even at very high doses," and a RAND report authored by the U.S. Defense department undersecretary charged with evaluating DU hazards considered the debate to be more political than scientific. A 2001 oncology study concluded that "the present scientific consensus is that DU exposure to humans, in locations where DU ammunition was deployed, is very unlikely to give rise to cancer induction". Former NATO Secretary General Lord Robertson stated in 2001 that "the existing medical consensus is clear. The hazard from depleted uranium is both very limited, and limited to very specific circumstances". A 2002 study from the Australian defense ministry concluded that "there has been no established increase in mortality or morbidity in workers exposed to uranium in uranium processing industries...
Sources: en.wikipedia.org
In the early nineteenth century, it was still undecided which port would be chosen as the primary sea link along the route from London to Dublin: Porthdinllaen, on the Llŷn Peninsula, or Holyhead in Anglesey. In May 1806, the Porthdinlleyn Harbour Act 1806 (46 Geo. 3. c. xxxiv) approved new buildings in Porthdinllaen when it seemed that the town would be chosen. Porthdinllaen was almost as far west as Holyhead, but Holyhead was more accessible because of Thomas Telford's road developments. Porthdinllaen Harbour Company was formed in 1808 in preparation, but the bill before Parliament to constitute Porthdinllaen as a harbour for Irish trade was rejected in 1810. Holyhead's maritime importance was at its height in the 19th century with a 1+3⁄4-mile-long (2.8-kilometre) sea breakwater. Holyhead Breakwater, built to create a safe harbour for vessels caught in stormy waters on their way to Liverpool and the industrial ports of Lancashire; it is the longest breakwater in the UK. Throughout the later 18th century and the entire 19th century, Holyhead was a crucial transit point for landed gentry and British parliamentarians and military officials who were travelling from Ireland to London. It was also a transit point for British owners of multinational estates visiting their 'other lands' or London houses. The port of Holyhead saw significant development throughout the 19th century to accommodate the growing passenger traffic between Holyhead and Dublin, which reached approximately 14,000 passengers annually by 1814.
== History == The nitrophenyl ethers are a well-known class of herbicides, the oldest member of which was nitrofen, invented by Rohm & Haas and first registered for sale in 1964. This area of chemistry became very competitive, with the Mobil Oil Corporation's filing in 1969 and grant in 1974 of a patent to the structural analog with a COOCH3 group adjacent to the nitro group of nitrofen. This product, bifenox, was launched with the brand name Mowdown in 1981. Meanwhile, Rohm & Haas introduced acifluorfen (as its sodium salt with brand name Blazer) in 1980, having developed it under the code number RH-6201. It had much improved properties including a wider spectrum of herbicidal effect and good safety to soybean crops. The first patent for the material was published in December 1975, although an earlier Belgian patent published in September 1973 had described related chemistry.
== Further reading == Pohlschroder, Mechthild; Pfeiffer, Friedhelm; Schulze, Stefan; Halim, Mohd Farid Abdul (1 September 2018). "Archaeal cell surface biogenesis". FEMS Microbiology Reviews. 42 (5): 694–717. doi:10.1093/femsre/fuy027. PMC 6098224. PMID 29912330.
In practice, PCR can fail for various reasons, such as sensitivity or contamination. Contamination with extraneous DNA can lead to spurious products and is addressed with lab protocols and procedures that separate pre-PCR mixtures from potential DNA contaminants. For instance, if DNA from a crime scene is analyzed, a single DNA molecule from lab personnel could be amplified and misguide the investigation. Hence the PCR-setup areas is separated from the analysis or purification of other PCR products, disposable plasticware used, and the work surface between reaction setups needs to be thoroughly cleaned. Specificity can be adjusted by experimental conditions so that no spurious products are generated. Primer-design techniques are important in improving PCR product yield and in avoiding the formation of unspecific products. The usage of alternate buffer components (such as DMSO to help denature DNA) or polymerase enzymes can help with amplification of long or otherwise problematic regions of DNA. For instance, Q5 polymerase is said to be ≈280 times less error-prone than Taq polymerase, and more processive. Both the running parameters (e.g. temperature and duration of cycles), or the addition of reagents, such as formamide, may increase the specificity and yield of PCR. Computer simulations of theoretical PCR results (Electronic PCR) may be performed to assist in primer design.
The United Kingdom dismissed the warnings of Winston Churchill and a few others about a continuing Marxist-Leninist threat, and opened trade relations and de facto diplomatic recognition in 1922. There was hope for a settlement of the pre-war Tsarist debts, but it was repeatedly postponed. Formal recognition came when the new Labour Party came to power in 1924. All the other countries followed suit in opening trade relations. Henry Ford opened large-scale business relations with the Soviets in the late 1920s, hoping that it would lead to long-term peace. Finally, in 1933, the United States officially recognized the USSR, a decision backed by the public opinion and especially by US business interests that expected an opening of a new profitable market. In the late 1920s and early 1930s, Stalin ordered Marxist-Leninist parties across the world to strongly oppose non-Marxist political parties, labour unions or other organizations on the left, which they labelled social fascists. In the usage of the Soviet Union, and of the Comintern and its affiliated parties in this period, the epithet fascist was used to describe capitalist society in general and virtually any anti-Soviet or anti-Stalinist activity or opinion. Stalin reversed himself in 1934 with the Popular Front program that called on all Marxist parties to join with all anti-Fascist political, labour, and organizational forces that were opposed to fascism, especially of the Nazi variety.
Sources: en.wikipedia.org
==== Inverted-V ==== When operating on the midvault of the nose, it is important to reattach the upper lateral cartilages to the nasal septum. Failure to do so may cause the upper lateral cartilages to collapse inward and caudaully, creating an upside-down "V" shadow. Inverted-V deformities are typically corrected with spreader grafts to restore the internal nasal valve.
=== Other types === RIT 4385 is a newer strain derived from the Jeryl Lynn strain by Maurice Hilleman, Jeryl Lynn's father. Leningrad-3 strain was developed by Smrodintsev and Klyachko in guinea pig kidney cell culture and has been used since 1950 in former Soviet countries. This vaccine is routinely used in Russia. L-Zagreb strain used in Croatia and India was derived from the Leningrad-3 strain by further passaging. Urabe strain was introduced in Japan, and later licensed in Belgium, France and Italy. It has been associated with a higher incidence of meningitis (1/143 000 versus 1/227 000 for J-L), and abandoned in several countries. It was formulated as MMR in the UK. Rubini strain used mainly in Switzerland was attenuated by a higher number of passes through chicken embryos, and later proved to have low potency. It was introduced in 1985.
== External links == Bio Products Laboratory website BPL's US website Tim Sandle's history of BPL 1954-2004 [1] History of Bio Products Laboratory at 60 (1954 – 2014) [2] * Sandle, T. (2004). A Brief History of Bio Products Laboratory and the Elstree Site
==== MeSH D13.444.735 – rna ==== MeSH D13.444.735.130 – rna, algal MeSH D13.444.735.150 – rna, antisense MeSH D13.444.735.150.319 – micrornas MeSH D13.444.735.150.640 – oligoribonucleotides, antisense MeSH D13.444.735.150.700 – rna, small interfering MeSH D13.444.735.300 – rna, archaeal MeSH D13.444.735.473 – rna, bacterial MeSH D13.444.735.476 – rna, chloroplast MeSH D13.444.735.480 – rna, complementary MeSH D13.444.735.490 – rna, double-stranded MeSH D13.444.735.500 – rna, fungal MeSH D13.444.735.520 – rna, helminth MeSH D13.444.735.544 – rna, messenger MeSH D13.444.735.544.355 – codon MeSH D13.444.735.544.355.225 – codon, initiator MeSH D13.444.735.544.355.250 – codon, terminator MeSH D13.444.735.544.355.250.235 – codon, nonsense MeSH D13.444.735.544.500 – rna caps MeSH D13.444.735.544.500.710 – rna cap analogs MeSH D13.444.735.544.527 – rna, messenger, stored MeSH D13.444.735.544.550 – rna splice sites MeSH D13.444.735.544.875 – untranslated regions MeSH D13.444.735.544.875.880 – 3' untranslated regions MeSH D13.444.735.544.875.885 – 5' untranslated regions MeSH D13.444.735.615 – rna, neoplasm MeSH D13.444.735.628 – rna, nuclear MeSH D13.444.735.628.806 – rna, heterogeneous nuclear MeSH D13.444.735.628.818 – rna, small nuclear MeSH D13.444.735.628.818.800 – rna, small nucleolar MeSH D13.444.735.635 – rna, plant MeSH D13.444.735.635.575 – rna, chloroplast MeSH D13.444.735.640 – rna precursors MeSH D13.444.735.650 – rna, protozoan MeSH D13.444.735.686 – rna, ribosomal MeSH D13.444.735.686.650 – rna, ribosomal, 5s MeSH D13.444.735.686.660 – rna, ribosomal, 5.8s MeSH D13.444.735.686.670 – rna, ribosomal, 16s MeSH D13.444.735.686.675 – rna, ribosomal, 18s MeSH D13.444.735.686.680 – rna, ribosomal, 23s MeSH D13.444.735.686.690 – rna, ribosomal, 28s MeSH D13.444.735.686.845 – rna, ribosomal, self-splicing MeSH D13.444.735.721 – rna, satellite MeSH D13.444.735.721.250 – cucumber mosaic virus satellite MeSH D13.444.735.757 – rna, transfer MeSH D13.444.735.757.286 – anticodon MeSH D13.444.735.757.700 – rna, transfer, amino acid-specific MeSH D13.444.735.757.700.050 – rna, transfer, ala MeSH D13.444.735.757.700.075 – rna, transfer, arg MeSH D13.444.735.757.700.085 – rna, transfer, asn MeSH D13.444.735.757.700.090 – rna, transfer, asp MeSH D13.444.735.757.700.200 – rna, transfer, cys MeSH D13.444.735.757.700.400 – rna, transfer, gln MeSH D13.444.735.757.700.410 – rna, transfer, glu MeSH D13.444.735.757.700.420 – rna, transfer, gly MeSH D13.444.735.757.700.450 – rna, transfer, his MeSH D13.444.735.757.700.480 – rna, transfer, ile MeSH D13.444.735.757.700.500 – rna, transfer, leu MeSH D13.444.735.757.700.510 – rna, transfer, lys MeSH D13.444.735.757.700.525 – rna, transfer, met MeSH D13.444.735.757.700.650 – rna, transfer, phe MeSH D13.444.735.757.700.660 – rna, transfer, pro MeSH D13.444.735.757.700.700 – rna, transfer, ser MeSH D13.444.735.757.700.725 – rna, transfer, thr MeSH D13.444.735.757.700.740 – rna, transfer, trp MeSH D13.444.735.757.700.750 – rna, transfer, tyr MeSH D13.444.735.757.700.900 – rna, transfer, val MeSH D13.444.735.757.715 – rna, transfer, amino acyl MeSH D13.444.735.790 – rna, untranslated MeSH D13.444.735.790.099 – micrornas MeSH D13.444.735.790.149 – regulatory sequences, ribonucleic acid MeSH D13.444.735.790.199 – rna, catalytic MeSH D13.444.735.790.400 – rna, guide MeSH D13.444.735.790.530 – rna, small cytoplasmic MeSH D13.444.735.790.537 – rna, small interfering MeSH D13.444.735.790.545 – rna, small nuclear MeSH D13.444.735.790.545.800 – rna, small nucleolar MeSH D13.444.735.790.560 – rna, spliced leader MeSH D13.444.735.790.878 – untranslated regions MeSH D13.444.735.790.878.880 – 3' untranslated regions MeSH D13.444.735.790.878.885 – 5' untranslated regions MeSH D13.444.735.828 – rna, viral
Nuclear magnetic resonance spectroscopy of proteins (usually abbreviated protein NMR) is a field of structural biology in which NMR spectroscopy is used to obtain information about the structure and dynamics of proteins, and also nucleic acids, and their complexes. The field was pioneered by Richard R. Ernst and Kurt Wüthrich at the ETH, and by Ad Bax, Marius Clore, Angela Gronenborn at the NIH, and Gerhard Wagner at Harvard University, among others. Structure determination by NMR spectroscopy usually consists of several phases, each using a separate set of highly specialized techniques. The sample is prepared, measurements are made, interpretive approaches are applied, and a structure is calculated and validated. NMR involves the quantum-mechanical properties of the central core ("nucleus") of the atom. These properties depend on the local molecular environment, and their measurement provides a map of how the atoms are linked chemically, how close they are in space, and how rapidly they move with respect to each other. These properties are fundamentally the same as those used in the more familiar magnetic resonance imaging (MRI), but the molecular applications use a somewhat different approach, appropriate to the change of scale from millimeters (of interest to radiologists) to nanometers (bonded atoms are typically a fraction of a nanometer apart), a factor of a million. This change of scale requires much higher sensitivity of detection and stability for long term measurement.
Sources: en.wikipedia.org
GSH is the reduced form of glutathione, with a free thiol group on cysteine. GSSG is the oxidized disulfide form, created when two GSH molecules become linked. The two forms exist together, and their balance is often reported as the GSH/GSSG ratio in laboratory studies.
Glutathione is synthesized inside cells from amino acids rather than being classified as an essential dietary nutrient. Dietary sources can provide glutathione or its precursors, but digestion and absorption alter what reaches tissues. Research continues on how dietary intake relates to cellular glutathione levels.
The liver has high glutathione concentrations and uses the compound in conjugation and antioxidant reactions. These reactions are relevant to the processing of drugs, pollutants, and normal metabolic byproducts. Studies often examine liver glutathione as a marker of oxidative stress or detoxification capacity.
Glutathione is a tripeptide of three amino acids: glutamate, cysteine, and glycine. The cysteine residue provides the sulfhydryl group that gives the molecule its reducing properties.